PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG131700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 24865.9 Da    PI: 6.4065
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG131700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.17.2e-261059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         rien   rqvtfskRr g++KKAeEL vLCda+va+i++s tgkl  ++s
  Pavir.4NG131700.1.p 10 RIENAAARQVTFSKRRRGLFKKAEELAVLCDADVALIVISATGKLSQFAS 59
                         8*********************************************9986 PP

2K-box59.31.6e-20891711698
                K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                            q +++ L++++ +  r +R++ Ge+Le Ls++eL+q+e++Le +l ++ s+K++l+++qi+elq+k  +l++en+ L+k++
  Pavir.4NG131700.1.p  89 VEQSKYSGLNEQLTEASRGLRQMRGEELEGLSVEELHQMERKLEAGLHRVLSTKDQLFMQQISELQQKGAQLEDENRLLKKQV 171
                          45778888899999999***************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.375161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-33160IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-22323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-28375IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241057IPR002100Transcription factor, MADS-box
CDDcd002654.45E-321375No hitNo description
PRINTSPR004041.2E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-223859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.8687177IPR002487Transcription factor, K-box
PfamPF014861.1E-1991171IPR002487Transcription factor, K-box
Gene3DG3DSA:1.20.5.4908.7E-4148171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MARERRAIRR IENAAARQVT FSKRRRGLFK KAEELAVLCD ADVALIVISA TGKLSQFASS  60
SMNDIIDKYS THSKNLGKSH QQPSIDLNVE QSKYSGLNEQ LTEASRGLRQ MRGEELEGLS  120
VEELHQMERK LEAGLHRVLS TKDQLFMQQI SELQQKGAQL EDENRLLKKQ VPHVITAGAA  180
VVAADTENVL TEDGQSSESV MTALHSGSSH DNDDGSDISL KLSLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D5e-17273172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-17273172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-17273172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A5e-17273172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S6e-17173173Myocyte-specific enhancer factor 2B
1tqe_R6e-17173173Myocyte-specific enhancer factor 2B
1tqe_Q6e-17173173Myocyte-specific enhancer factor 2B
1tqe_P6e-17173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.123140.0leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306350.0AJ430635.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m21 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964865.11e-148PREDICTED: MADS-box transcription factor 55-like
SwissprotQ69TG51e-113MAD55_ORYSJ; MADS-box transcription factor 55
SwissprotQ9XJ661e-114MAD22_ORYSJ; MADS-box transcription factor 22
TrEMBLQ84V761e-133Q84V76_MAIZE; M21 protein (Fragment)
STRINGSb10g007380.11e-132(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12213697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.15e-51MIKC_MADS family protein